PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017170P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 339aa    MW: 38378.2 Da    PI: 8.7769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017170P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
   MELO3C017170P1 15 KGPWTPEEDIILVSYIHQHGPGNWRSVPNNTGLLRCSKSCRLRWTNYL 62
                     79******************************99************97 PP

2Myb_DNA-binding45.41.8e-1468113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E+  +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
   MELO3C017170P1  68 RGDFSDDEENVIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 113
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.3481066IPR017930Myb domain
SuperFamilySSF466891.05E-2814109IPR009057Homeodomain-like
SMARTSM007171.2E-141464IPR001005SANT/Myb domain
PfamPF002491.2E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-221669IPR009057Homeodomain-like
CDDcd001675.48E-111762No hitNo description
SMARTSM007178.3E-1467115IPR001005SANT/Myb domain
PROSITE profilePS5129420.01767117IPR017930Myb domain
PfamPF002494.1E-1368113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2370118IPR009057Homeodomain-like
CDDcd001674.84E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGRPPCCSQT IVVKKGPWTP EEDIILVSYI HQHGPGNWRS VPNNTGLLRC SKSCRLRWTN  60
YLRPGIKRGD FSDDEENVIV HLQALLGNRW AAIASYLPQR TDNDIKNYWN THLKKKLKLG  120
FDDQSSQSPP PPHHHHDLQK NGNFSKGQWE RRLQTDIQTA KQALREALSL TTKQNFIQNN  180
NNNSKLLFLS SPTPNKNNNK QFHVSSSSSS SPSSSSSSSS SSSTYVSNAE NIAELLKNWT  240
KNSPNKAMAR SRNSESSSSC QNNNNNCSNL WVEEEISYYS NNNNNNVQDG GVPFNLLEKW  300
LFDEAAPTLQ HHPQYHPQHQ DDHFLHLSLQ DSQAPFFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453202.10.0PREDICTED: myb-related protein 306-like
SwissprotP813926e-94MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0A0LUH31e-177A0A0A0LUH3_CUCSA; Uncharacterized protein
STRINGSolyc03g116100.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.24e-85myb domain protein 96